Antibody data

Product number
ARP35763_P050
Provider
Aviva Systems Biology
Proper citation
Aviva Systems Biology Cat#ARP35763_P050, RRID:AB_10879821
Product name
Dlx6 antibody - C-terminal region (ARP35763_P050)
Provider product page
Aviva Systems Biology - ARP35763_P050
Antibody type
Polyclonal
Antigen
Synthetic peptide
Description
This is a rabbit polyclonal antibody against Dlx6. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Reactivity
Human, Rat
Host
Rabbit
Antigen sequence
FQQTQYLALPERAELAASLGLTQTQVKIWFQNKRS
KFKKLLKQGSNPHES
Vial size
50 µg
Concentration
1 mg/ml
Handling
Add 50 µl of distilled water. Final anti-Dlx6 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.