AV35764

DLX6 antibody from MilliporeSigma / Merck KGaA
No application information provided.

Antibody data

Product number
AV35764
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-DLX6 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV35764
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human DLX6 with an internal ID of P07016
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKP
RTIYSSLQLQALNHR
Storage
-20C