HPA003643

antibody from Atlas Antibodies

Targeting: TST RDS

Antibody data

Submit

Validation data

Product number: HPA003643 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA003643, RRID:AB_1080411
Product name: Anti-TST
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASW YSPGTREARKEYLERHVPGASFFDIEECRDTASPY EMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGS FYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPV TSEPS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TST protein structure - HPA003643 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human colon and lymph node tissues using Anti-TST antibody. Corresponding TST RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and pancreas using Anti-TST antibody HPA003643 (A) shows similar protein distribution across tissues to independent antibody HPA003044 (B).
Antibody #2 product nr: HPA003044
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-TST antibody HPA003643.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-TST antibody HPA003643.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-TST antibody HPA003643.
Sample type: HUMAN