Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009973-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009973-M03, RRID:AB_1672310
- Product name
- CCS monoclonal antibody (M03), clone 1E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CCS.
- Antigen sequence
ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR
GGHPLSKITGNSGERLACGIIARSAGLFQNPKQIC
SCDGLTIWEERGRPIAGKGRKESAQPPAHL- Isotype
- IgG
- Antibody clone number
- 1E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Impaired copper and iron metabolism in blood cells and muscles of patients affected by copper deficiency myeloneuropathy.
Spinazzi M, Sghirlanzoni A, Salviati L, Angelini C
Neuropathology and applied neurobiology 2014 Dec;40(7):888-98
Neuropathology and applied neurobiology 2014 Dec;40(7):888-98
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CCS expression in transfected 293T cell line by CCS monoclonal antibody (M03), clone 1E2.Lane 1: CCS transfected lysate (Predicted MW: 29 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CCS is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CCS on HeLa cell . [antibody concentration 40 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of CCS transfected lysate using anti-CCS monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CCS monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CCS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol