HPA059914

IFIT3 antibody from Atlas Antibodies
CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, RIG-G
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA059914
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA059914, RRID:AB_2684159
Product name
Anti-IFIT3
Provider product page
Atlas Antibodies - HPA059914
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLS
ASELEDGSEEMGQGAVSSSPRELLSNSEQL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -