H00003437-D01

IFIT3 antibody from Abnova Corporation
CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, RIG-G

Antibody data

Product number
H00003437-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003437-D01, RRID:AB_10632118
Product name
IFIT3 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00003437-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human IFIT3 protein.
Antigen sequence
MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLE
DRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAA
LECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYY
HLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDC
EEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSG
LAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVK
VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLR
SAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQ
IGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAM
DYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK
EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEG
LSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL
QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGS
IFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -