Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057154-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057154-M01, RRID:AB_566195
- Product name
- SMURF1 monoclonal antibody (M01), clone 1D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMURF1.
- Antigen sequence
DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVE
SPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSP
ELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP- Isotype
- IgG
- Antibody clone number
- 1D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Impaired phosphorylation and ubiquitination by p70 S6 kinase (p70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promote tribbles homolog 2 (TRIB2) stability and carcinogenic property in liver cancer.
Smurf1 ubiquitin ligase causes downregulation of BMP receptors and is induced in monocrotaline and hypoxia models of pulmonary arterial hypertension.
Wang J, Zhang Y, Weng W, Qiao Y, Ma L, Xiao W, Yu Y, Pan Q, Sun F
The Journal of biological chemistry 2013 Nov 22;288(47):33667-33681
The Journal of biological chemistry 2013 Nov 22;288(47):33667-33681
Smurf1 ubiquitin ligase causes downregulation of BMP receptors and is induced in monocrotaline and hypoxia models of pulmonary arterial hypertension.
Murakami K, Mathew R, Huang J, Farahani R, Peng H, Olson SC, Etlinger JD
Experimental biology and medicine (Maywood, N.J.) 2010 Jul;235(7):805-13
Experimental biology and medicine (Maywood, N.J.) 2010 Jul;235(7):805-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SMURF1 expression in transfected 293T cell line by SMURF1 monoclonal antibody (M01), clone 1D7.Lane 1: SMURF1 transfected lysate(83.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SMURF1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SMURF1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of SMURF1 transfected lysate using anti-SMURF1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SMURF1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SMURF1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
