Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109459 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SNF8, ESCRT-II Complex Subunit, Homolog (S. Cerevisiae) (SNF8) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQ
MSKQLDMFKTNLEEF- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Cloning and characterization of the EAP30 subunit of the ELL complex that confers derepression of transcription by RNA polymerase II.
Schmidt AE, Miller T, Schmidt SL, Shiekhattar R, Shilatifard A
The Journal of biological chemistry 1999 Jul 30;274(31):21981-5
The Journal of biological chemistry 1999 Jul 30;274(31):21981-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-EAP30 Antibody Titration: 5.0ug/ml. Positive Control: HepG2 cell lysate. SNF8 is supported by BioGPS gene expression data to be expressed in HepG2.; EAP30 antibody - N-terminal region (AP42040PU-N) in Human HepG2 cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Heart; EAP30 antibody - N-terminal region (AP42040PU-N) in Human Heart cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Stomach; Rabbit Anti-EAP30 Antibody. Paraffin Embedded Tissue: Human Stomach. Cellular Data: Epithelial cells of Fundic Gland and Surface Mucous Cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X; EAP30 antibody - N-terminal region (AP42040PU-N) in Human Stomach cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Spleen; EAP30 antibody - N-terminal region (AP42040PU-N) in Human Spleen cells using Immunohistochemistry