Antibody data

Product number
HPA048593
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA048593, RRID:AB_2680455
Product name
Anti-GAS2L3
Provider product page
Atlas Antibodies - HPA048593
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LQFATLEQKILAFQKGVSNESVPDSPARTPQPPEM
NPLSAVNMFQKQNSKPSVPVSIPKSKEKQGRPPGA
LVPASSLKGGNLGSMSVRSKLPNSPAASSHPKLKS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.