Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009149-M10 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009149-M10, RRID:AB_1137180
- Product name
- DYRK1B monoclonal antibody (M10), clone 2E8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DYRK1B.
- Antigen sequence
DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPL
RPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRY
LGRPPSPTSPPPPELMDVSLV- Isotype
- IgG
- Antibody clone number
- 2E8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of DYRK1B expression in transfected 293T cell line by DYRK1B monoclonal antibody (M10), clone 2E8.Lane 1: DYRK1B transfected lysate (Predicted MW: 69.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DYRK1B is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to DYRK1B on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol