HPA052936

ZIC3 antibody from Atlas Antibodies
HTX, HTX1, ZNF203
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA052936
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052936, RRID:AB_2681993
Product name
Anti-ZIC3
Provider product page
Atlas Antibodies - HPA052936
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HEQGAGHPSPTGHVDNNQVHLGLRGELFGRADPYR
PVA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -