Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002800-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002800-M01, RRID:AB_530062
- Product name
- GOLGA1 monoclonal antibody (M01), clone 6G3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GOLGA1.
- Antigen sequence
EKPGPEMANMAPSVTNNTDLTDAREINFEYLKHVV
LKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKET
LEYKMSWFGSKPAPKGSIRPSISNPRIPWS- Isotype
- IgG
- Antibody clone number
- 6G3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis.
Teoh KT, Siu YL, Chan WL, Schlüter MA, Liu CJ, Peiris JS, Bruzzone R, Margolis B, Nal B
Molecular biology of the cell 2010 Nov 15;21(22):3838-52
Molecular biology of the cell 2010 Nov 15;21(22):3838-52
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GOLGA1 monoclonal antibody (M01), clone 6G3 Western Blot analysis of GOLGA1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GOLGA1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol