Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000387-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000387-M05, RRID:AB_464042
- Product name
- RHOA monoclonal antibody (M05), clone 1C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant RHOA.
- Antigen sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYV
PTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKH
FCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK
PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMAT
RAALQARRGKKKSGCLVL- Isotype
- IgG
- Antibody clone number
- 1C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RHOA monoclonal antibody (M05), clone 1C1 Western Blot analysis of RHOA expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA monoclonal antibody (M05), clone 1C1.Lane 1: RHOA transfected lysate(21.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RHOA is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RHOA on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between MAPK8 and RHOA. HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-RHOA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
