HPA041698

antibody from Atlas Antibodies

Targeting: BLVRB FLR, SDR43U1

Antibody data

Submit

Validation data

Product number: HPA041698 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041698, RRID:AB_10796781
Product name: Anti-BLVRB
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVT LDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYP SHQYQ
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

BLVRB protein structure - HPA041698 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Western blot analysis in human cell lines A-549 and U-251MG using Anti-BLVRB antibody. Corresponding BLVRB RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Orthogonal method: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Western blot analysis using Anti-BLVRB antibody HPA041698 (A) shows similar pattern to independent antibody HPA041937 (B).
Antibody #2 product nr: HPA041937
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Sample type: MOUSE, RAT

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, small intestine and spleen using Anti-BLVRB antibody HPA041698 (A) shows similar protein distribution across tissues to independent antibody HPA041937 (B).
Antibody #2 product nr: HPA041937
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in subsets of cells in red and white pulp.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.
Sample type: HUMAN