Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000645-M09 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000645-M09, RRID:AB_581657
- Product name
- BLVRB monoclonal antibody (M09), clone 2F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BLVRB.
- Antigen sequence
VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRE
SGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVI
SKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ- Isotype
- IgG
- Antibody clone number
- 2F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The heme degradation pathway is a promising serum biomarker source for the early detection of Alzheimer's disease.
Mueller C, Zhou W, Vanmeter A, Heiby M, Magaki S, Ross MM, Espina V, Schrag M, Dickson C, Liotta LA, Kirsch WM
Journal of Alzheimer's disease : JAD 2010;19(3):1081-91
Journal of Alzheimer's disease : JAD 2010;19(3):1081-91
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BLVRB expression in transfected 293T cell line by BLVRB monoclonal antibody (M09), clone 2F4.Lane 1: BLVRB transfected lysate(22.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BLVRB is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol