SAB1400276

TDG antibody from MilliporeSigma / Merck KGaA
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1400276
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1400276, RRID:AB_1857865
Product name
Anti-TDG antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1400276
Antibody type
Polyclonal
Antigen
TDG (AAH37557.1, a.a. 1-410) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVV
NEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEP
KQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVK
RKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGIN
PGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNH
MDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFRE
GGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGV
KVKNLEFGLQPHKIPDTETLCYGMPSSSARCAQFP
RAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTF
DLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENP
CSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMT
QSFTDQIPSFSNHCGTQEQEEESHA (without
GST)
Storage
-20C
Provider Type Product Number
- No reagents -