Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA029700 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA029700, RRID:AB_10599278
- Product name
- Anti-APEH
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLW
VSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDF
EAILLQPGSPPDKTQVP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Lens crystallin modifications and cataract in transgenic mice overexpressing acylpeptide hydrolase.
Santhoshkumar P, Xie L, Raju M, Reneker L, Sharma KK
The Journal of biological chemistry 2014 Mar 28;289(13):9039-52
The Journal of biological chemistry 2014 Mar 28;289(13):9039-52
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-APEH antibody HPA029700 (A) shows similar pattern to independent antibody HPA029702 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and pancreas tissues using Anti-APEH antibody. Corresponding APEH RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-APEH antibody HPA029700.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas using Anti-APEH antibody HPA029700.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-APEH antibody HPA029700.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-APEH antibody HPA029700.
- Sample type
- HUMAN