Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00063891-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00063891-M01, RRID:AB_490080
- Product name
- RNF123 monoclonal antibody (M01), clone 3F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RNF123.
- Antigen sequence
ADYISADELAQVEQMLAHLTSASAQAAAASLPTSE
EDLCPICYAHPISAVFQPCGHKSCKACINQHLMNN
KDCFFCKTTIVSVEDWEKGANTSTTSSAA- Isotype
- IgG
- Antibody clone number
- 3F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Proteasomes can degrade a significant proportion of cellular proteins independent of ubiquitination.
Baugh JM, Viktorova EG, Pilipenko EV
Journal of molecular biology 2009 Feb 27;386(3):814-27
Journal of molecular biology 2009 Feb 27;386(3):814-27
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RNF123 monoclonal antibody (M01), clone 3F8 Western Blot analysis of RNF123 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RNF123 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol