HPA036262

antibody from Atlas Antibodies

Targeting: TRAIP RNF206, TRIP

Antibody data

Submit

Validation data

Product number: HPA036262 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036262, RRID:AB_2675029
Product name: Anti-TRAIP
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LNLPPVASETVDRLVLESPAPVEVNLKLRRPSFRD DIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHS PIQDVPKKICKGPRKESQLSL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TRAIP protein structure - HPA036262 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and testis using Anti-TRAIP antibody HPA036262 (A) shows similar protein distribution across tissues to independent antibody HPA036261 (B).
Antibody #2 product nr: HPA036261
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-TRAIP antibody HPA036262.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-TRAIP antibody HPA036262.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-TRAIP antibody HPA036262.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-TRAIP antibody HPA036262.
Sample type: HUMAN