Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000558-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000558-M01, RRID:AB_518674
- Product name
- AXL monoclonal antibody (M01), clone 6C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AXL.
- Antigen sequence
TQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEP
PEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVV
SQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVG
LEGLPY- Isotype
- IgG
- Antibody clone number
- 6C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Axl/Gas6/NFκB signalling in schwannoma pathological proliferation, adhesion and survival.
Ammoun S, Provenzano L, Zhou L, Barczyk M, Evans K, Hilton DA, Hafizi S, Hanemann CO
Oncogene 2014 Jan 16;33(3):336-46
Oncogene 2014 Jan 16;33(3):336-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- AXL monoclonal antibody (M01), clone 6C8 Western Blot analysis of AXL expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of AXL expression in transfected 293T cell line by AXL monoclonal antibody (M01), clone 6C8.Lane 1: AXL transfected lysate(98 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AXL is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
