Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183160 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-gamma-aminobutyric Acid (GABA) A Receptor, epsilon (GABRE) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GABRE antibody: synthetic peptide directed towards the middle region of human GABRE
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFF
NVSRR FGYVAFQNYV- Vial size
- 50 µg
Submitted references Expression of GABAA α2-, β1- and ε-receptors are altered significantly in the lateral cerebellum of subjects with schizophrenia, major depression and bipolar disorder.
Increased GABA(A) receptor ε-subunit expression on ventral respiratory column neurons protects breathing during pregnancy.
Changes in ventral respiratory column GABAaR ε- and δ-subunits during hibernation mediate resistance to depression by EtOH and pentobarbital.
GABA(A) receptor epsilon and theta subunits display unusual structural variation between species and are enriched in the rat locus ceruleus.
Fatemi SH, Folsom TD, Rooney RJ, Thuras PD
Translational psychiatry 2013 Sep 10;3:e303
Translational psychiatry 2013 Sep 10;3:e303
Increased GABA(A) receptor ε-subunit expression on ventral respiratory column neurons protects breathing during pregnancy.
Hengen KB, Nelson NR, Stang KM, Johnson SM, Crader SM, Watters JJ, Mitchell GS, Behan M
PloS one 2012;7(1):e30608
PloS one 2012;7(1):e30608
Changes in ventral respiratory column GABAaR ε- and δ-subunits during hibernation mediate resistance to depression by EtOH and pentobarbital.
Hengen KB, Gomez TM, Stang KM, Johnson SM, Behan M
American journal of physiology. Regulatory, integrative and comparative physiology 2011 Feb;300(2):R272-83
American journal of physiology. Regulatory, integrative and comparative physiology 2011 Feb;300(2):R272-83
GABA(A) receptor epsilon and theta subunits display unusual structural variation between species and are enriched in the rat locus ceruleus.
Sinkkonen ST, Hanna MC, Kirkness EF, Korpi ER
The Journal of neuroscience : the official journal of the Society for Neuroscience 2000 May 15;20(10):3588-95
The Journal of neuroscience : the official journal of the Society for Neuroscience 2000 May 15;20(10):3588-95
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
