HPA048532

antibody from Atlas Antibodies

Targeting: SLC9A1 APNH, NHE1, PPP1R143

Antibody data

Submit

Validation data

Product number: HPA048532 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA048532, RRID:AB_2680431
Product name: Anti-SLC9A1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQML LRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIG SDPLAYEPKEDLPVITIDPA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC9A1 protein structure - HPA048532 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human stomach and liver tissues using Anti-SLC9A1 antibody. Corresponding SLC9A1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and stomach using Anti-SLC9A1 antibody HPA048532 (A) shows similar protein distribution across tissues to independent antibody HPA052891 (B).
Antibody #2 product nr: HPA052891
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows moderate cell membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SLC9A1 antibody HPA048532.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SLC9A1 antibody HPA048532.
Sample type: HUMAN