HPA061458

SPAG9 antibody from Atlas Antibodies
CT89, FLJ13450, FLJ14006, FLJ26141, FLJ34602, HLC4, HSS, JIP-4, JIP4, JLP, KIAA0516, MGC117291, MGC14967, MGC74461, PHET, PIG6, SYD1

Antibody data

Product number
HPA061458
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA061458, RRID:AB_2684528
Product name
Anti-SPAG9
Provider product page
Atlas Antibodies - HPA061458
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRS
ASQSSLDKLDQELKEQQKELKNQEELSSLVWICTS
THSATKVL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -