Antibody data

Product number
H00010248-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010248-M13, RRID:AB_1713220
Product name
POP7 monoclonal antibody (M13), clone 3F12
Provider product page
Abnova Corporation - H00010248-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant POP7.
Antigen sequence
MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPN
DIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIY
IHGLGLAINH
Isotype
IgG
Antibody clone number
3F12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.