HPA034990

AFTPH antibody from Atlas Antibodies
FLJ20080, FLJ23793, MGC33965, Nbla10388
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA034990
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA034990, RRID:AB_2674398
Product name
Anti-AFTPH
Provider product page
Atlas Antibodies - HPA034990
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNA
FEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTD
ENIDTPGTPKTHSVP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -