PAB22647

AFTPH antibody from Abnova Corporation
FLJ20080, FLJ23793, MGC33965, Nbla10388

Antibody data

Product number
PAB22647
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22647, RRID:AB_10964982
Product name
AFTPH polyclonal antibody
Provider product page
Abnova Corporation - PAB22647
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant AFTPH.
Antigen sequence
RENNKINRVNELNSVKEVALGRSLDNKGDTDGEDQ
VCVSEISIVTNRGFSVEKQGLPTLQQDEFLQSGVQ
SK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -