HPA041038

STX12 antibody from Atlas Antibodies
STX13, STX14
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA041038
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041038, RRID:AB_10794261
Product name
Anti-STX12
Provider product page
Atlas Antibodies - HPA041038
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSYGPLDVYRNPGPSGPQLRDFSSIIQTCSGNIQR
ISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHST
NQLAKETNELLKE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -