SAB1400469

STX12 antibody from MilliporeSigma / Merck KGaA
STX13, STX14
ELISA
Recommended by provider

Antibody data

Product number
SAB1400469
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1400469, RRID:AB_1857621
Product name
Anti-STX12 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1400469
Antibody type
Polyclonal
Antigen
STX12 (NP_803173.1, a.a. 1-276) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQR
ISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHST
NQLAKETNELLKELGSLPLPLSTSEQRQQRLQKER
LMNDFSAALNNFQAVQRRVSEKEKESIARARAGSR
LSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITE
QDLELIKERETAIRQLEADILDVNQIFKDLAMMIH
DQGDLIDSIEANVESSEVHVERATEQLQRAAYYQK
KSRKKMCILVLVLSVIILILGLIIWLVYKTK (wi
thout GST)
Storage
-20C
Provider Type Product Number
- No reagents -