Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005223-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005223-M01, RRID:AB_425589
- Product name
- PGAM1 monoclonal antibody (M01), clone 2G1-A6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PGAM1.
- Antigen sequence
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGH
EEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV
LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAA
KHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR
RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQI
KEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL
PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEA
VAAQGKAKK- Isotype
- IgG
- Antibody clone number
- 2G1-A6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Comparative proteomic profiling of human bile reveals SSP411 as a novel biomarker of cholangiocarcinoma.
High prevalence of autoantibodies against phosphoglycerate mutase 1 in patients with autoimmune central nervous system diseases.
Shen J, Wang W, Wu J, Feng B, Chen W, Wang M, Tang J, Wang F, Cheng F, Pu L, Tang Q, Wang X, Li X
PloS one 2012;7(10):e47476
PloS one 2012;7(10):e47476
High prevalence of autoantibodies against phosphoglycerate mutase 1 in patients with autoimmune central nervous system diseases.
Kimura A, Sakurai T, Koumura A, Yamada M, Hayashi Y, Tanaka Y, Hozumi I, Tanaka R, Takemura M, Seishima M, Inuzuka T
Journal of neuroimmunology 2010 Feb 26;219(1-2):105-8
Journal of neuroimmunology 2010 Feb 26;219(1-2):105-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PGAM1 monoclonal antibody (M01), clone 2G1-A6 Western Blot analysis of PGAM1 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PGAM1 expression in transfected 293T cell line by PGAM1 monoclonal antibody (M01), clone 2G1-A6.Lane 1: PGAM1 transfected lysate (Predicted MW: 28.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PGAM1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol