Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028985 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028985, RRID:AB_10602142
- Product name
- Anti-PHACTR4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMT
PTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEED
EDESYQSALANKVKRKDTLAMKLNHRPSE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references STOP gene Phactr4 is a tumor suppressor.
Solimini NL, Liang AC, Xu C, Pavlova NN, Xu Q, Davoli T, Li MZ, Wong KK, Elledge SJ
Proceedings of the National Academy of Sciences of the United States of America 2013 Jan 29;110(5):E407-14
Proceedings of the National Academy of Sciences of the United States of America 2013 Jan 29;110(5):E407-14
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
- Sample type
- HUMAN