Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056287-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056287-M01, RRID:AB_426031
- Product name
- GKN1 monoclonal antibody (M01), clone 2E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GKN1.
- Antigen sequence
NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNN
GWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEV
MPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNP
NKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFF
YSGTCYTTSVLWIVDISFCGDTVEN- Isotype
- IgG
- Antibody clone number
- 2E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Anti-amyloidogenic property of human gastrokine 1.
Downregulation of gastrokine-1 in gastric cancer tissues and restoration of its expression induced gastric cancer cells to apoptosis.
Helicobacter pylori infection and administration of non-steroidal anti-inflammatory drugs down-regulate the expression of gastrokine-1 in gastric mucosa.
Characterization of the human gastric fluid proteome reveals distinct pH-dependent protein profiles: implications for biomarker studies.
Altieri F, Di Stadio CS, Severino V, Sandomenico A, Minopoli G, Miselli G, Di Maro A, Ruvo M, Chambery A, Quagliariello V, Masullo M, Rippa E, Arcari P
Biochimie 2014 Nov;106:91-100
Biochimie 2014 Nov;106:91-100
Downregulation of gastrokine-1 in gastric cancer tissues and restoration of its expression induced gastric cancer cells to apoptosis.
Mao W, Chen J, Peng TL, Yin XF, Chen LZ, Chen MH
Journal of experimental & clinical cancer research : CR 2012 May 23;31:49
Journal of experimental & clinical cancer research : CR 2012 May 23;31:49
Helicobacter pylori infection and administration of non-steroidal anti-inflammatory drugs down-regulate the expression of gastrokine-1 in gastric mucosa.
Mao W, Chen J, Peng TL, Yin XF, Chen LZ, Chen MH
The Turkish journal of gastroenterology : the official journal of Turkish Society of Gastroenterology 2012 Jun;23(3):212-9
The Turkish journal of gastroenterology : the official journal of Turkish Society of Gastroenterology 2012 Jun;23(3):212-9
Characterization of the human gastric fluid proteome reveals distinct pH-dependent protein profiles: implications for biomarker studies.
Kam SY, Hennessy T, Chua SC, Gan CS, Philp R, Hon KK, Lai L, Chan WH, Ong HS, Wong WK, Lim KH, Ling KL, Tan HS, Tan MM, Ho M, Kon OL
Journal of proteome research 2011 Oct 7;10(10):4535-46
Journal of proteome research 2011 Oct 7;10(10):4535-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5.Lane 1: GKN1 transfected lysate(20 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GKN1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol