Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311664 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Testis Expressed 14 (TEX14) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TEX14 antibody: synthetic peptide directed towards the C terminal of human TEX14
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQV
SGEEK FQMRKILGKN- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references In vitro and ex vivo green fluorescent protein expression in alveolar mammary epithelial cells and mammary glands driven by the distal 5'-regulative sequence and intron 1 of the goat beta-casein gene.
Sequence and expression of testis-expressed gene 14 (Tex14): a gene encoding a protein kinase preferentially expressed during spermatogenesis.
Wu HT, Lin CS, Huang MC
Reproduction, fertility, and development 2003;15(4):231-9
Reproduction, fertility, and development 2003;15(4):231-9
Sequence and expression of testis-expressed gene 14 (Tex14): a gene encoding a protein kinase preferentially expressed during spermatogenesis.
Wu MH, Rajkovic A, Burns KH, Yan W, Lin YN, Matzuk MM
Gene expression patterns : GEP 2003 May;3(2):231-6
Gene expression patterns : GEP 2003 May;3(2):231-6
No comments: Submit comment
No validations: Submit validation data