Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084171-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084171-A01, RRID:AB_462028
- Product name
- LOXL4 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LOXL4.
- Antigen sequence
ACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPG
NYIFQVIVNPHYEVAESDFSNNMLQCRCKYDGHRV
WLHNCHTGNSYPANAELSLEQEQRLRNNL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Alternatively spliced lysyl oxidase-like 4 isoforms have a pro-metastatic role in cancer.
Lysyl oxidase-like 4 is alternatively spliced in an anatomic site-specific manner in tumors involving the serosal cavities.
Sebban S, Golan-Gerstl R, Karni R, Vaksman O, Davidson B, Reich R
Clinical & experimental metastasis 2013 Jan;30(1):103-17
Clinical & experimental metastasis 2013 Jan;30(1):103-17
Lysyl oxidase-like 4 is alternatively spliced in an anatomic site-specific manner in tumors involving the serosal cavities.
Sebban S, Davidson B, Reich R
Virchows Archiv : an international journal of pathology 2009 Jan;454(1):71-9
Virchows Archiv : an international journal of pathology 2009 Jan;454(1):71-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LOXL4 polyclonal antibody (A01), Lot # ABNOVA060620QCS1. Western Blot analysis of LOXL4 expression in SW-13.
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LOXL4 polyclonal antibody (A01), Lot # ABNOVA060620QCS1. Western Blot analysis of LOXL4 expression in Raw 264.7.
- Protocol
- Protocol
