HPA034810

antibody from Atlas Antibodies

Targeting: ASPRV1 FLJ25084, SASPase, Taps

Antibody data

Submit

Validation data

Product number: HPA034810 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA034810, RRID:AB_10601456
Product name: Anti-ASPRV1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSG AQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGA EMKILGVWDTAVSL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ASPRV1 protein structure - HPA034810 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skin and liver tissues using Anti-ASPRV1 antibody. Corresponding ASPRV1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, liver and skin using Anti-ASPRV1 antibody HPA034810 (A) shows similar protein distribution across tissues to independent antibody HPA034809 (B).
Antibody #2 product nr: HPA034809
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human vulva/anal skin shows strong cytoplasmic positivity in superficial squamous epithelial cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-ASPRV1 antibody HPA034810.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ASPRV1 antibody HPA034810.
Sample type: HUMAN