Antibody data

Product number
H00023316-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023316-M03, RRID:AB_10967250
Product name
CUX2 monoclonal antibody (M03), clone 2H8
Provider product page
Abnova Corporation - H00023316-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CUX2.
Antigen sequence
FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAG
PTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQ
EVQITLAARLGEAEEKIKVLHSALKATQAE
Isotype
IgG
Antibody clone number
2H8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -