H00254225-M01A

RNF169 antibody from Abnova Corporation
KIAA1991
No application information provided.

Antibody data

Product number
H00254225-M01A
Provider
Abnova Corporation
Product name
RNF169 monoclonal antibody (M01A), clone 3B6
Provider product page
Abnova Corporation - H00254225-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RNF169.
Antigen sequence
SLSEEPLPSLRRGRKRHCKTKHLEQNGSLKKLRQT
SGEVGLAPTDPVLREMEQKLQQEEEDRQLALQLQR
MFDNERRTVSRRKGSVDQYLLRSSNMAGAK
Isotype
IgM
Antibody clone number
3B6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -