H00254225-A01

RNF169 antibody from Abnova Corporation
KIAA1991
No application information provided.

Antibody data

Product number
H00254225-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00254225-A01, RRID:AB_463031
Product name
KIAA1991 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00254225-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant KIAA1991.
Antigen sequence
SLSEEPLPSLRRGRKRHCKTKHLEQNGSLKKLRQT
SGEVGLAPTDPVLREMEQKLQQEEEDRQLALQLQR
MFDNERRTVSRRKGSVDQYLLRSSNMAGAK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -