CH22113
antibody from Neuromics
Targeting: MAPT
DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND, PPP1R103, tau
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- CH22113 - Provider product page
- Provider
- Neuromics
- Proper citation
- Neuromics Cat#CH22113, RRID:AB_2737136
- Product name
- Anti-MAPT
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein fragment
- Description
- Microtubule Associated Protein tau
- Reactivity
- Human
- Host
- Chicken/Avian
- Antigen sequence
GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAI
HPFTP- Isotype
- IgY
- Vial size
- 100 µl
- Concentration
- 0.04 mg/ml
- Storage
- "For continuous use store at 2-8°C for one-two days. For extended storage store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours."
- Handling
- The antibody solution should be gently mixed before use.
No comments: Submit comment
No validations: Submit validation data