Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064211-M10 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064211-M10, RRID:AB_894174
- Product name
- LHX5 monoclonal antibody (M10), clone 2C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant LHX5.
- Antigen sequence
VCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDA
LQDDPKETDNSTSSDKETANNENEEQNSGTKRRG- Isotype
- IgG
- Antibody clone number
- 2C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LHX5 monoclonal antibody (M10), clone 2C6. Western Blot analysis of LHX5 expression in human pancreas.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LHX5 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol