Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001636-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001636-M01, RRID:AB_518705
- Product name
- ACE monoclonal antibody (M01), clone 6A4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ACE.
- Antigen sequence
RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY
FKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYN
ETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTRE
APVYM- Isotype
- IgG
- Antibody clone number
- 6A4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Phosphorylation of the eukaryotic translation initiation factor 4E-transporter (4E-T) by c-Jun N-terminal kinase promotes stress-dependent P-body assembly.
The dual organization of P-bodies revealed by immunoelectron microscopy and electron tomography.
Drosophila genome-wide RNAi screen identifies multiple regulators of HIF-dependent transcription in hypoxia.
Cargnello M, Tcherkezian J, Dorn JF, Huttlin EL, Maddox PS, Gygi SP, Roux PP
Molecular and cellular biology 2012 Nov;32(22):4572-84
Molecular and cellular biology 2012 Nov;32(22):4572-84
The dual organization of P-bodies revealed by immunoelectron microscopy and electron tomography.
Cougot N, Cavalier A, Thomas D, Gillet R
Journal of molecular biology 2012 Jun 29;420(1-2):17-28
Journal of molecular biology 2012 Jun 29;420(1-2):17-28
Drosophila genome-wide RNAi screen identifies multiple regulators of HIF-dependent transcription in hypoxia.
Dekanty A, Romero NM, Bertolin AP, Thomas MG, Leishman CC, Perez-Perri JI, Boccaccio GL, Wappner P
PLoS genetics 2010 Jun 24;6(6):e1000994
PLoS genetics 2010 Jun 24;6(6):e1000994
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ACE is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol