Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038851 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA038851, RRID:AB_10673479
- Product name
- Anti-FBXW8
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTV
LCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFL
ESEDEEDEPGMQPNVSFVRINSSLAVAA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Both ubiquitin ligases FBXW8 and PARK2 are sequestrated into insolubility by ATXN2 PolyQ expansions, but only FBXW8 expression is dysregulated.
Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?
Halbach MV, Stehning T, Damrath E, Jendrach M, Şen NE, Başak AN, Auburger G
PloS one 2015;10(3):e0121089
PloS one 2015;10(3):e0121089
Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?
Fahlbusch F, Dawood Y, Hartner A, Menendez-Castro C, Nögel S, Tzschoppe A, Schneider H, Strissel P, Beckmann M, Schleussner E, Ruebner M, Dörr H, Schild R, Rascher W, Dötsch J
The Journal of Maternal-Fetal & Neonatal Medicine 2012 July;25(11):2209-2215
The Journal of Maternal-Fetal & Neonatal Medicine 2012 July;25(11):2209-2215
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human thyroid gland and skeletal muscle tissues using Anti-FBXW8 antibody. Corresponding FBXW8 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human thyroid gland shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows low expression as expected.
- Sample type
- HUMAN