Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006615-M10 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006615-M10, RRID:AB_1112141
- Product name
- SNAI1 monoclonal antibody (M10), clone 2G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SNAI1.
- Antigen sequence
LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFN
CKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFS
RPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRA
HLQTH- Isotype
- IgG
- Antibody clone number
- 2G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Isolation and characterization of a population of stem-like progenitor cells from an atypical meningioma.
Rath P, Miller DC, Litofsky NS, Anthony DC, Feng Q, Franklin C, Pei L, Free A, Liu J, Ren M, Kirk MD, Shi H
Experimental and molecular pathology 2011 Apr;90(2):179-88
Experimental and molecular pathology 2011 Apr;90(2):179-88
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SNAI1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HCC36 cells were stained with SNAI1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).
- Validation comment
- Immunofluorescence (Circulating Tumor Cell)