Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502165 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 26, Member 4 (SLC26A4) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC26A4 antibody: synthetic peptide directed towards the middle region of human SLC26A4
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEK
NYNAG IVKSIPRGFL- Vial size
- 50 µg
Submitted references Identification of pendrin as a common mediator for mucus production in bronchial asthma and chronic obstructive pulmonary disease.
Nakao I, Kanaji S, Ohta S, Matsushita H, Arima K, Yuyama N, Yamaya M, Nakayama K, Kubo H, Watanabe M, Sagara H, Sugiyama K, Tanaka H, Toda S, Hayashi H, Inoue H, Hoshino T, Shiraki A, Inoue M, Suzuki K, Aizawa H, Okinami S, Nagai H, Hasegawa M, Fukuda T, Green ED, Izuhara K
Journal of immunology (Baltimore, Md. : 1950) 2008 May 1;180(9):6262-9
Journal of immunology (Baltimore, Md. : 1950) 2008 May 1;180(9):6262-9
No comments: Submit comment
No validations: Submit validation data