Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001811-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001811-M01, RRID:AB_607037
- Product name
- SLC26A3 monoclonal antibody (M01), clone 2E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLC26A3.
- Antigen sequence
TQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKI
FRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRN
KALRKIRKLQKQGLLQVTPKGFICTVDT- Isotype
- IgG
- Antibody clone number
- 2E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ion transport mechanisms linked to bicarbonate secretion in the esophageal submucosal glands.
Abdulnour-Nakhoul S, Nakhoul HN, Kalliny MI, Gyftopoulos A, Rabon E, Doetjes R, Brown K, Nakhoul NL
American journal of physiology. Regulatory, integrative and comparative physiology 2011 Jul;301(1):R83-96
American journal of physiology. Regulatory, integrative and comparative physiology 2011 Jul;301(1):R83-96
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SLC26A3 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SLC26A3 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 1.8 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol