Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008726-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008726-M05, RRID:AB_1674814
- Product name
- EED monoclonal antibody (M05), clone 3B12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EED.
- Antigen sequence
KIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKM
LALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGA
AIRQTSFSRDSSILIAVCDDASIWRWDRLR- Isotype
- IgG
- Antibody clone number
- 3B12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Interplay between Homeobox proteins and Polycomb repressive complexes in p16INK⁴a regulation.
Martin N, Popov N, Aguilo F, O'Loghlen A, Raguz S, Snijders AP, Dharmalingam G, Li S, Thymiakou E, Carroll T, Zeisig BB, So CW, Peters G, Episkopou V, Walsh MJ, Gil J
The EMBO journal 2013 Apr 3;32(7):982-95
The EMBO journal 2013 Apr 3;32(7):982-95
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged EED is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol