Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023682-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023682-M02, RRID:AB_606902
- Product name
- RAB38 monoclonal antibody (M02), clone 7F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB38.
- Antigen sequence
PNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKE
HGFVGWFETSAKENINIDEASRCLVKHILANECDL
MESIEPDVVKPHLTSTKVASCSGCAKS- Isotype
- IgG
- Antibody clone number
- 7F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references miRNA expression profiling in melanocytes and melanoma cell lines reveals miRNAs associated with formation and progression of malignant melanoma.
Mueller DW, Rehli M, Bosserhoff AK
The Journal of investigative dermatology 2009 Jul;129(7):1740-51
The Journal of investigative dermatology 2009 Jul;129(7):1740-51
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RAB38 monoclonal antibody (M02), clone 7F1 Western Blot analysis of RAB38 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RAB38 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol