H00002909-M01
antibody from Abnova Corporation
Targeting: ARHGAP35
GRF-1, GRLF1, KIAA1722, P190A, p190ARhoGAP, p190RhoGAP
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002909-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002909-M01, RRID:AB_425465
- Product name
- GRLF1 monoclonal antibody (M01), clone 4D4-F8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GRLF1.
- Antigen sequence
MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGL
R- Isotype
- IgG
- Antibody clone number
- 4D4-F8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GRLF1 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol