WH0011133M1

KPTN antibody from MilliporeSigma / Merck KGaA
2E4
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0011133M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0011133M1, RRID:AB_1842178
Product name
Monoclonal Anti-KPTN antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0011133M1
Antibody type
Monoclonal
Antigen
KPTN (AAH09249, a.a. 1-437) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGA
GGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQ
FNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDS
GDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQ
FTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKE
NEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFP
GTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVL
QDGPISRVIV (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -