Antibody data

Product number
H00011133-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011133-M01, RRID:AB_622338
Product name
KPTN monoclonal antibody (M01), clone 1C7
Provider product page
Abnova Corporation - H00011133-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant KPTN.
Antigen sequence
MMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGA
GGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQ
FNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDS
GDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQ
FTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKE
NEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFP
GTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVL
QDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASM
LEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLV
TDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEA
QHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVV
SLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQ
GLEDGAGAGPAENAAS
Isotype
IgG
Antibody clone number
1C7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -