H00003192-M03
antibody from Abnova Corporation
Targeting: HNRNPU
C1orf199, FLJ30202, FLJ37978, HNRNPU-AS1, HNRPU, NCRNA00201, SAF-A
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003192-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003192-M03, RRID:AB_1674799
- Product name
- HNRNPU monoclonal antibody (M03), clone 4G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HNRNPU.
- Antigen sequence
LLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDV
ITCFANFESDEVELSYAKNGQDLGVAFKISKEVLA
GRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTF
IQNV- Isotype
- IgG
- Antibody clone number
- 4G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HNRNPU monoclonal antibody (M03), clone 4G11. Western Blot analysis of HNRNPU expression in NIH/3T3(Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HNRNPU is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol